PDB entry 1cwm

View 1cwm on RCSB PDB site
Description: human cyclophilin a complexed with 4 meile cyclosporin
Class: isomerase/immunosuppressant
Keywords: isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, cyclosporin a, immunosuppressant, cyclophilin
Deposited on 1998-05-26, released 1998-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cwma_
  • Chain 'C':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cwmA (A:)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

  • Chain 'C':
    No sequence available.