PDB entry 1cwj

View 1cwj on RCSB PDB site
Description: human cyclophilin a complexed with 2-val 3-s-methyl-sarcosine cyclosporin
Deposited on 1998-05-25, released 1998-08-26
The last revision prior to the SCOP 1.57 freeze date was dated 1998-08-26, with a file datestamp of 1998-08-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1cwja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cwjA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle