PDB entry 1cwh

View 1cwh on RCSB PDB site
Description: human cyclophilin a complexed with 3-d-ser cyclosporin
Class: complex (isomerase/immunosuppressant)
Keywords: complex (isomerase/immunosuppressant)
Deposited on 1998-05-07, released 1998-07-15
The last revision prior to the SCOP 1.75 freeze date was dated 1998-07-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.194
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: HOMO SAPIENS
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cwha_
  • Chain 'C':
    Compound: cyclosporin a
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cwhA (A:)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

  • Chain 'C':
    No sequence available.