PDB entry 1cwc

View 1cwc on RCSB PDB site
Description: improved binding affinity for cyclophilin a by a cyclosporin derivative singly modified at its effector domain
Class: isomerase/immunosuppressant
Keywords: isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, cyclosporin a, immunosuppressant, cyclophilin
Deposited on 1995-09-06, released 1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.177
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cwca_
  • Chain 'C':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cwcA (A:)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

  • Chain 'C':
    No sequence available.