PDB entry 1cwb

View 1cwb on RCSB PDB site
Description: the x-ray structure of (mebm2t)1-cyclosporin complexed with cyclophilin a provides an explanation for its anomalously high immunosuppressive activity
Deposited on 1995-09-06, released 1996-01-29
The last revision prior to the SCOP 1.57 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.162
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1cwba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cwbA (A:)
  mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
  mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
  wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle