PDB entry 1cw5

View 1cw5 on RCSB PDB site
Description: solution structure of carnobacteriocin b2
Deposited on 1999-08-25, released 1999-09-07
The last revision prior to the SCOP 1.67 freeze date was dated 2000-04-02, with a file datestamp of 2000-04-02.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1cw5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cw5A (A:)
    vnygngvscsktkcsvnwgqafqerytaginsfvsgvasgagsigrrp