PDB entry 1cw5

View 1cw5 on RCSB PDB site
Description: solution structure of carnobacteriocin b2
Class: toxin
Keywords: antimicrobial peptide, helix, bacteriocin, toxin
Deposited on 1999-08-25, released 1999-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: type iia bacteriocin carnobacteriocin b2
  Species: Carnobacterium maltaromaticum [TaxId:2751]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38580 (0-47)
  Domains in SCOPe 2.08: d1cw5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cw5A (A:)
  vnygngvscsktkcsvnwgqafqerytaginsfvsgvasgagsigrrp