PDB entry 1cvz

View 1cvz on RCSB PDB site
Description: crystal structure analysis of papain with clik148(cathepsin l specific inhibitor)
Class: hydrolase
Keywords: papain, clik148, cathepsin l inhibitor, sulfhydryl proteinase, hydrolase
Deposited on 1999-08-24, released 2000-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00784 (0-211)
      • sequence conflict (46)
      • sequence conflict (117)
      • sequence conflict (134)
    Domains in SCOPe 2.08: d1cvza_
  • Heterogens: C48, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cvzA (A:)
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn