PDB entry 1cvs

View 1cvs on RCSB PDB site
Description: crystal structure of a dimeric fgf2-fgfr1 complex
Deposited on 1999-08-24, released 2000-01-28
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-28, with a file datestamp of 2000-01-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cvsA (A:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cvsB (B:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cvsC (C:)
    mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
    ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpanktva
    lgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttdkemevlhl
    rnvsfedageytclagnsiglshhsawltvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cvsD (D:)
    mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
    ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpanktva
    lgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttdkemevlhl
    rnvsfedageytclagnsiglshhsawltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvsD (D:)
    mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
    ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpanktva
    lgsnvefmckvysdpqphiqwlkhvqilktagvnttdkemevlhlrnvsfedageytcla
    gnsiglshhsawltvl