PDB entry 1cvs

View 1cvs on RCSB PDB site
Description: crystal structure of a dimeric fgf2-fgfr1 complex
Class: growth factor/growth factor receptor
Keywords: fgf, fgfr, immunoglobulin-like, signal transduction, dimerization, growth factor/growth factor receptor complex
Deposited on 1999-08-24, released 2000-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered mutation (54)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d1cvsa_
  • Chain 'B':
    Compound: fibroblast growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered mutation (54)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d1cvsb_
  • Chain 'C':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (44)
    Domains in SCOPe 2.07: d1cvsc1, d1cvsc2
  • Chain 'D':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (44)
    Domains in SCOPe 2.07: d1cvsd1, d1cvsd2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cvsA (A:)
    ghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryl
    amkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgq
    kailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvsA (A:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cvsB (B:)
    ghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryl
    amkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgq
    kailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvsB (B:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cvsC (C:)
    tdntkpnrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpd
    hriggykvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqag
    lpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttd
    kemevlhlrnvsfedageytclagnsiglshhsawltvlealeer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvsC (C:)
    mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
    ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpanktva
    lgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttdkemevlhl
    rnvsfedageytclagnsiglshhsawltvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cvsD (D:)
    tdntkpnrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpd
    hriggykvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqag
    lpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttd
    kemevlhlrnvsfedageytclagnsiglshhsawltvlealeer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvsD (D:)
    mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
    ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpanktva
    lgsnvefmckvysdpqphiqwlkhvqilktagvnttdkemevlhlrnvsfedageytcla
    gnsiglshhsawltvl