PDB entry 1cvr

View 1cvr on RCSB PDB site
Description: Crystal structure of the Arg specific cysteine proteinase gingipain R (RGPB)
Class: hydrolase/hydrolase inhibitor
Keywords: CASPASES, CYSTEINE PROTEINASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1999-08-24, released 2000-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.163
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gingipain r
    Species: Porphyromonas gingivalis [TaxId:837]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cvra1, d1cvra2
  • Heterogens: H37, CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cvrA (A:)
    ytpveekengrmivivakkyegdikdfvdwknqrglrtevkvaediaspvtanaiqqfvk
    qeyekegndltyvllvgdhkdipakitpgiksdqvygqivgndhynevfigrfscesked
    lktqidrtihyernittedkwlgqalciasaeggpsadngesdiqhenvianlltqygyt
    kiikcydpgvtpkniidafnggislvnytghgsetawgtshfgtthvkqltnsnqlpfif
    dvacvngdflfsmpcfaealmraqkdgkptgtvaiiastidqywappmrgqdemneilce
    khpnnikrtfggvtmngmfamvekykkdgenmldtwtvfgdpsllvrtlvptemqvtapa
    nisasaqtfevacdyngaiatlsddgdmvgtaivkdgkaiiklnesiadetnltltvvgy
    nkvtvikdvkvegts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvrA (A:)
    ytpveekengrmivivakkyegdikdfvdwknqrglrtevkvaediaspvtanaiqqfvk
    qeyekegndltyvllvgdhkdipakitpgiksdqvygqivgndhynevfigrfscesked
    lktqidrtihyernittedkwlgqalciasaeggpsadngesdiqhenvianlltqygyt
    kiikcydpgvtpkniidafnggislvnytghgsetawgtshfgtthvkqltnsnqlpfif
    dvacvngdflfsmpcfaealmraqkdgkptgtvaiiastidqywappmrgqdemneilce
    khpnnikrtfggvtmngmfamvekykkdgenmldtwtvfgdpsllvrtlvptemqvtapa
    nisasaqtfevacdyngaiatlsddgdmvgtaivkdgkaiiklnesiadetnltltvvgy
    nkvtvikdvkve