PDB entry 1cvo

View 1cvo on RCSB PDB site
Description: the solution structure of cardiotoxin v from naja naja atra
Class: cytotoxin
Keywords: cytotoxin
Deposited on 1993-04-28, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cardiotoxin v
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cvoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cvoA (A:)
    lkchntqlpfiyktcpegknlcfkatlkkfplkfpvkrgcadncpknsallkyvccstdk
    cn