PDB entry 1cvm

View 1cvm on RCSB PDB site
Description: cadmium inhibited crystal structure of phytase from bacillus amyloliquefaciens
Class: hydrolase
Keywords: thermostable bacillus phytase phytate phosphatase cadmium calcium, hydrolase
Deposited on 1999-08-24, released 2000-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phytase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66037 (0-352)
      • conflict (307)
    Domains in SCOPe 2.07: d1cvma_
  • Heterogens: CA, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cvmA (A:)
    klsdpyhftvnaaaetepvdtagdaaddpaiwldpknpqnsklittnkksglavyslegk
    mlhsyhtgklnnvdirydfplngkkvdiaaasnrsegkntieiyaidgkngtlqsitdpn
    rpiasaidevygfslyhsqktgkyyamvtgkegefeqyelnadkngyisgkkvrafkmns
    qtegmaaddeygslyiaeedeaiwkfsaepdggsngtvidradgrhltpdiegltiyyaa
    dgkgyllassqgnssyaiyerqgqnkyvadfqitdgpetdgtsdtdgidvlgfglgpeyp
    fglfvaqngenidhgqkanqnfkmvpweriadkigfhpqvnkqvdprkmtdrs