PDB entry 1cvj

View 1cvj on RCSB PDB site
Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate RNA
Class: gene regulation/RNA
Keywords: rrm, protein-RNA complex, gene regulation-RNA complex
Deposited on 1999-08-23, released 1999-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyadenylate binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cvja1, d1cvja2
  • Chain 'B':
    Compound: polyadenylate binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cvjb1, d1cvjb2
  • Chain 'C':
    Compound: polyadenylate binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cvjc1, d1cvjc2
  • Chain 'D':
    Compound: polyadenylate binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cvjd1, d1cvjd2
  • Chain 'E':
    Compound: polyadenylate binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cvje1, d1cvje2
  • Chain 'F':
    Compound: polyadenylate binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cvjf1, d1cvjf2
  • Chain 'G':
    Compound: polyadenylate binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cvjg1, d1cvjg2
  • Chain 'H':
    Compound: polyadenylate binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cvjh1, d1cvjh2
  • Chain 'M':
    Compound: 5'-r(*ap*ap*ap*ap*ap*ap*ap*ap*ap*ap*a)-3'
    Species:
    Gene:
  • Chain 'N':
    Compound: 5'-r(*ap*ap*ap*ap*ap*ap*ap*ap*ap*ap*a)-3'
    Species:
    Gene:
  • Chain 'O':
    Compound: 5'-r(*ap*ap*ap*ap*ap*ap*ap*ap*ap*ap*a)-3'
    Species:
    Gene:
  • Chain 'P':
    Compound: 5'-r(*ap*ap*ap*ap*ap*ap*ap*ap*ap*ap*a)-3'
    Species:
    Gene:
  • Chain 'Q':
    Compound: 5'-r(*ap*ap*ap*ap*ap*ap*ap*ap*ap*ap*a)-3'
    Species:
    Gene:
  • Chain 'R':
    Compound: 5'-r(*ap*ap*ap*ap*ap*ap*ap*ap*ap*ap*a)-3'
    Species:
    Gene:
  • Chain 'S':
    Compound: 5'-r(*ap*ap*ap*ap*ap*ap*ap*ap*ap*ap*a)-3'
    Species:
    Gene:
  • Chain 'T':
    Compound: 5'-r(*ap*ap*ap*ap*ap*ap*ap*ap*ap*ap*a)-3'
    Species:
    Gene:
  • Heterogens: A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cvjA (A:)
    mnpsapsypmaslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfq
    qpadaeraldtmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfs
    afgnilsckvvcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrkere
    aelgarakef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjA (A:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrker
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cvjB (B:)
    mnpsapsypmaslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfq
    qpadaeraldtmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfs
    afgnilsckvvcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrkere
    aelgarakef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjB (B:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcskgygfvhfetqeaaeraiekmnvgrfks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cvjC (C:)
    mnpsapsypmaslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfq
    qpadaeraldtmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfs
    afgnilsckvvcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrkere
    aelgarakef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjC (C:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cvjD (D:)
    mnpsapsypmaslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfq
    qpadaeraldtmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfs
    afgnilsckvvcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrkere
    aelgarakef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjD (D:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcskgygfvhfetqeaaeraiekmngmllndrkvfvgrfks
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1cvjE (E:)
    mnpsapsypmaslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfq
    qpadaeraldtmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfs
    afgnilsckvvcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrkere
    aelgarakef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjE (E:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1cvjF (F:)
    mnpsapsypmaslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfq
    qpadaeraldtmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfs
    afgnilsckvvcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrkere
    aelgarakef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjF (F:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgninkalydtfsafgnilsckvvcskgygfvh
    fetqevfvgrf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1cvjG (G:)
    mnpsapsypmaslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfq
    qpadaeraldtmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfs
    afgnilsckvvcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrkere
    aelgarakef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjG (G:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfsafgnilsckv
    vcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfks
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1cvjH (H:)
    mnpsapsypmaslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfq
    qpadaeraldtmnfdvikgkpvrimwsqrdpslrksgvgnifiknldksidnkalydtfs
    afgnilsckvvcdengskgygfvhfetqeaaeraiekmngmllndrkvfvgrfksrkere
    aelgarakef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cvjH (H:)
    aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
    tmnfdvikgkpvrimwsqrdpslrksgvgnifikalydtfsafgnilsckvvcskgygfv
    hfetqeaaefks
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.