PDB entry 1cvi

View 1cvi on RCSB PDB site
Description: crystal structure of human prostatic acid phosphatase
Class: hydrolase
Keywords: acid phosphatase, inhibition, hydrolase
Deposited on 1999-08-23, released 1999-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prostatic acid phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cvia_
  • Chain 'B':
    Compound: prostatic acid phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cvib_
  • Chain 'C':
    Compound: prostatic acid phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cvic_
  • Chain 'D':
    Compound: prostatic acid phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cvid_
  • Heterogens: NAG, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cviA (A:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cviB (B:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cviC (C:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cviD (D:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt