PDB entry 1cv8

View 1cv8 on RCSB PDB site
Description: staphopain, cysteine proteinase from staphylococcus aureus v8
Class: cysteine protease
Keywords: cysteine protease, thiol protease, papain family
Deposited on 1998-05-08, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.183
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphopain
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cv8a_
  • Heterogens: ACT, E64, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cv8A (A:)
    yneqyvnklenfkiretqgnngwcagytmsallnatyntnkyhaeavmrflhpnlqgqqf
    qftgltpremiyfgqtqgrspqllnrmttynevdnltknnkgiailgsrvesrngmhagh
    amavvgnaklnngqeviiiwnpwdngfmtqdaknnvipvsngdhyqwyssiygy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cv8A (A:)
    neqyvnklenfkiretqgnngwcagytmsallnatyntnkyhaeavmrflhpnlqgqqfq
    ftgltpremiyfgqtqgrspqllnrmttynevdnltknnkgiailgsrvesrngmhagha
    mavvgnaklnngqeviiiwnpwdngfmtqdaknnvipvsngdhyqwyssiygy