PDB entry 1cv5

View 1cv5 on RCSB PDB site
Description: t4 lysozyme mutant l133m
Class: hydrolase
Keywords: hydrolase (o-glycosyl), t4 lysozyme, methionine core mutant, protein engineering, protein folding
Deposited on 1999-08-22, released 1999-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.157
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: GENE E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • engineered (53)
      • engineered (96)
      • engineered (132)
    Domains in SCOPe 2.07: d1cv5a_
  • Heterogens: CL, HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cv5A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnmaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cv5A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnmaksrwynqtpnrakrvittfrtgtwdayk