PDB entry 1cv2

View 1cv2 on RCSB PDB site
Description: Hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis UT26 AT 1.6 A resolution
Class: hydrolase
Keywords: dehalogenase, lindane, biodegradation, alpha/beta-hydrolase, hydrolase
Deposited on 1999-08-22, released 2000-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: SPHINGOMONAS PAUCIMOBILIS [TaxId:13689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cv2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cv2A (A:)
    mslgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrlia
    cdligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarr
    hrervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilr
    plseaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklf
    inaepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cv2A (A:)
    gakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacdl
    igmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhre
    rvqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrpls
    eaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfina
    epgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa