PDB entry 1cuw

View 1cuw on RCSB PDB site
Description: cutinase, g82a, a85f, v184i, a185l, l189f mutant
Class: hydrolase (serine esterase)
Keywords: hydrolase, serine esterase, glycoprotein, hydrolase (serine esterase)
Deposited on 1995-11-16, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.142
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cutinase
    Species: Nectria haematococca mpVI [TaxId:70791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00590
      • conflict (31)
      • engineered (81)
      • engineered (84)
      • engineered (183-184)
      • engineered (188)
    Domains in SCOPe 2.07: d1cuwa_
  • Chain 'B':
    Compound: cutinase
    Species: Nectria haematococca mpVI [TaxId:70791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00590
      • conflict (31)
      • engineered (81)
      • engineered (84)
      • engineered (183-184)
      • engineered (188)
    Domains in SCOPe 2.07: d1cuwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cuwA (A:)
    lptsnpaqelearqlgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratladnflprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctg
    sliilaphfaygpdargpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cuwA (A:)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratladnflprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgsliilaphfaygpdar
    gpapefliekvravrgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cuwB (B:)
    lptsnpaqelearqlgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratladnflprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctg
    sliilaphfaygpdargpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cuwB (B:)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratladnflprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgsliilaphfaygpdar
    gpapefliekvravrgs