PDB entry 1cus

View 1cus on RCSB PDB site
Description: fusarium solani cutinase is a lipolytic enzyme with a catalytic serine accessible to solvent
Class: hydrolase(serine esterase)
Keywords: hydrolase(serine esterase)
Deposited on 1994-04-06, released 1994-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cutinase
    Species: Nectria haematococca [TaxId:70791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00590
      • conflict (17)
    Domains in SCOPe 2.07: d1cusa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cusA (A:)
    lgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvg
    gayratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedld
    sairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpd
    argpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cusA (A:)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
    gpapefliekvravrgs