PDB entry 1cur

View 1cur on RCSB PDB site
Description: reduced rusticyanin, nmr
Class: electron transport
Keywords: rusticyanin, type 1 copper protein, solution structure, electron transport
Deposited on 1996-04-19, released 1996-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cu(I) rusticyanin
  Species: Acidithiobacillus ferrooxidans [TaxId:920]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24930 (0-154)
  Domains in SCOPe 2.08: d1cura_
• Heterogens: CU

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1curA (A:)
  gtldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkk
  nptleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkf
  gytdftwhptagtyyyvcqipghaatgmfgkivvk