PDB entry 1cuo

View 1cuo on RCSB PDB site
Description: crystal structure analysis of isomer-2 azurin from methylomonas j
Class: electron transport
Keywords: BETA BARREL, periplasmic, electron transport
Deposited on 1999-08-21, released 2000-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (azurin iso-2)
  Species: Methylomonas sp. J [TaxId:32038]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12335 (0-128)
  Domains in SCOPe 2.07: d1cuoa_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cuoA (A:)
  ascettvtsgdtmtystrsisvpascaeftvnfehkghmpktgmghnwvlaksadvgdva
  kegahagadnnfvtpgdkrviaftpiigggektsvkfkvsalskdeaytyfcsypghfsm
  mrgtlklee