PDB entry 1cuo

View 1cuo on RCSB PDB site
Description: crystal structure analysis of isomer-2 azurin from methylomonas j
Class: electron transport
Keywords: BETA BARREL, periplasmic, electron transport
Deposited on 1999-08-21, released 2000-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (azurin iso-2)
    Species: Methylomonas sp. J [TaxId:32038]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cuoa_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cuoA (A:)
    ascettvtsgdtmtystrsisvpascaeftvnfehkghmpktgmghnwvlaksadvgdva
    kegahagadnnfvtpgdkrviaftpiigggektsvkfkvsalskdeaytyfcsypghfsm
    mrgtlklee