PDB entry 1cuk

View 1cuk on RCSB PDB site
Description: escherichia coli ruva protein at ph 4.9 and room temperature
Class: helicase
Keywords: DNA repair, sos response, DNA-binding, DNA recombination, helicase
Deposited on 1996-08-28, released 1997-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ruva protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cuka1, d1cuka2, d1cuka3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cukA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftpaadlvltspaspatddaeqeavarlvalgykpqeasrm
    vskiarpdassetlirealraal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cukA (A:)
    migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
    ygfnnkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkkt
    aerlivemkdrfkglhgdlftptddaeqeavarlvalgykpqeasrmvskiarpdasset
    lirealraal