PDB entry 1cuh

View 1cuh on RCSB PDB site
Description: cutinase, r196e mutant
Class: hydrolase (serine esterase)
Keywords: hydrolase, serine esterase, glycoprotein, hydrolase (serine esterase)
Deposited on 1995-11-16, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.163
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cutinase
    Species: Nectria haematococca mpVI [TaxId:70791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00590
      • conflict (31)
      • engineered (195)
    Domains in SCOPe 2.07: d1cuha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cuhA (A:)
    lptsnpaqelearqlgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctg
    slivaaphlaygpdaegpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cuhA (A:)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdae
    gpapefliekvravrgs