PDB entry 1cue

View 1cue on RCSB PDB site
Description: cutinase, q121l mutant
Class: hydrolase (serine esterase)
Keywords: hydrolase, serine esterase, glycoprotein, hydrolase (serine esterase)
Deposited on 1995-11-16, released 1996-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.111
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cutinase
    Species: Nectria haematococca mpVI [TaxId:70791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00590 (0-196)
      • conflict (15)
      • engineered (104)
    Domains in SCOPe 2.08: d1cuea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cueA (A:)
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggyslgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
gpapefliekvravrgs