PDB entry 1cud

View 1cud on RCSB PDB site
Description: cutinase, n172k, r196d mutant, monoclinic crystal form with three molecules per asymmetric unit
Class: hydrolase (serine esterase)
Keywords: hydrolase, serine esterase, glycoprotein, hydrolase (serine esterase)
Deposited on 1995-11-16, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.141
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cutinase
    Species: Nectria haematococca mpVI [TaxId:70791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00590
      • conflict (31)
      • engineered (171)
      • engineered (195)
    Domains in SCOPe 2.07: d1cuda_
  • Chain 'B':
    Compound: cutinase
    Species: Nectria haematococca mpVI [TaxId:70791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00590
      • conflict (31)
      • engineered (171)
      • engineered (195)
    Domains in SCOPe 2.07: d1cudb_
  • Chain 'C':
    Compound: cutinase
    Species: Nectria haematococca mpVI [TaxId:70791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00590
      • conflict (31)
      • engineered (171)
      • engineered (195)
    Domains in SCOPe 2.07: d1cudc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cudA (A:)
    lptsnpaqelearqlgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctg
    slivaaphlaygpdaegpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cudA (A:)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdae
    gpapefliekvravrgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cudB (B:)
    lptsnpaqelearqlgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctg
    slivaaphlaygpdaegpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cudB (B:)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdae
    gpapefliekvravrgs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cudC (C:)
    lptsnpaqelearqlgrttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayratlgdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctg
    slivaaphlaygpdaegpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cudC (C:)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdae
    gpapefliekvravrgs