PDB entry 1cu6

View 1cu6 on RCSB PDB site
Description: t4 lysozyme mutant l91a
Deposited on 1999-08-20, released 1999-11-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-30, with a file datestamp of 2000-06-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.165
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cu6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cu6A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsadavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk