PDB entry 1cu4

View 1cu4 on RCSB PDB site
Description: crystal structure of the anti-prion fab 3f4 in complex with its peptide epitope
Class: immune system
Keywords: immunoglobulin fold
Deposited on 1999-08-20, released 2000-04-17
The last revision prior to the SCOP 1.75 freeze date was dated 2001-04-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.159
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1cu4h1, d1cu4h2
  • Chain 'L':
    Compound: Fab light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1cu4l1, d1cu4l2
  • Chain 'P':
    Compound: recognition peptide
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1cu4H (H:)
    kvklqqsgaelvrsgasvklsctasgfnikdyyiqwvkqrpeqglewigwidpengnsey
    aprfqgkatmtadtlsntaylqlssltsedtavyycnadlhdywgqgttltvssakttap
    svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkieprvts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cu4H (H:)
    klqqsgaelvrsgasvklsctasgfnikdyyiqwvkqrpeqglewigwidpengnseyap
    rfqgkatmtadtlsntaylqlssltsedtavyycnadlhdywgqgttltvssakttapsv
    yplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssv
    tvtsstwpsqsitcnvahpasstkvdkkieprvts
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cu4L (L:)
    dvvmtqtplslsvtigqpasisckssqslldsdgktyliwvfqrpgqspkrliflvskrd
    sgvpdrftgsgsgtdftlkisrveaedvgvyycwqgthfphtvgggtkleiaradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.