PDB entry 1cu4

View 1cu4 on RCSB PDB site
Description:
Deposited on 1999-08-20, released 2000-04-17
The last revision prior to the SCOP 1.65 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.159
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cu4h1, d1cu4h2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1cu4l1, d1cu4l2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1cu4H (H:)
    kvklqqsgaelvrsgasvklsctasgfnikdyyiqwvkqrpeqglewigwidpengnsey
    aprfqgkatmtadtlsntaylqlssltsedtavyycnadlhdywgqgttltvssakttap
    svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkieprvts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cu4H (H:)
    klqqsgaelvrsgasvklsctasgfnikdyyiqwvkqrpeqglewigwidpengnseyap
    rfqgkatmtadtlsntaylqlssltsedtavyycnadlhdywgqgttltvssakttapsv
    yplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssv
    tvtsstwpsqsitcnvahpasstkvdkkieprvts
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cu4L (L:)
    dvvmtqtplslsvtigqpasisckssqslldsdgktyliwvfqrpgqspkrliflvskrd
    sgvpdrftgsgsgtdftlkisrveaedvgvyycwqgthfphtvgggtkleiaradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec