PDB entry 1cu1

View 1cu1 on RCSB PDB site
Description: crystal structure of an enzyme complex from hepatitis c virus
Class: hydrolase
Keywords: hepatitis C Virus, bifunctional, protease-helicase, HYDROLASE
Deposited on 1999-08-20, released 2000-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (protease/helicase ns3)
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cu1a1, d1cu1a2, d1cu1a3
  • Chain 'B':
    Compound: protein (protease/helicase ns3)
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cu1b1, d1cu1b2, d1cu1b3
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cu1A (A:)
    gsvvivgriilsgsgsitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflat
    cvngvcwtvyhgagsktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlyl
    vtrhadvipvrrrgdsrgsllsprpvsylkgssggpllcpsghavgifraavctrgvaka
    vdfvpvesmettmrspvftdnssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvl
    vlnpsvaatlgfgaymskahgidpnirtgvrtittgapvtystygkfladggcsggaydi
    iicdechstdsttilgigtvldqaetagarlvvlatatppgsvtvphpnieevalsntge
    ipfygkaipieairggrhlifchskkkcdelaaklsglginavayyrgldvsviptigdv
    vvvatdalmtgytgdfdsvidcntcvtqtvdfsldptftietttvpqdavsrsqrrgrtg
    rgrrgiyrfvtpgerpsgmfdssvlcecydagcawyeltpaetsvrlraylntpglpvcq
    dhlefwesvftglthidahflsqtkqagdnfpylvayqatvcaraqapppswdqmwkcli
    rlkptlhgptpllyrlgavqnevtlthpitkyimacmsadlevvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cu1B (B:)
    gsvvivgriilsgsgsitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflat
    cvngvcwtvyhgagsktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlyl
    vtrhadvipvrrrgdsrgsllsprpvsylkgssggpllcpsghavgifraavctrgvaka
    vdfvpvesmettmrspvftdnssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvl
    vlnpsvaatlgfgaymskahgidpnirtgvrtittgapvtystygkfladggcsggaydi
    iicdechstdsttilgigtvldqaetagarlvvlatatppgsvtvphpnieevalsntge
    ipfygkaipieairggrhlifchskkkcdelaaklsglginavayyrgldvsviptigdv
    vvvatdalmtgytgdfdsvidcntcvtqtvdfsldptftietttvpqdavsrsqrrgrtg
    rgrrgiyrfvtpgerpsgmfdssvlcecydagcawyeltpaetsvrlraylntpglpvcq
    dhlefwesvftglthidahflsqtkqagdnfpylvayqatvcaraqapppswdqmwkcli
    rlkptlhgptpllyrlgavqnevtlthpitkyimacmsadlevvt