PDB entry 1cu0

View 1cu0 on RCSB PDB site
Description: t4 lysozyme mutant i78m
Class: hydrolase
Keywords: hydrolase (o-glycosyl), t4 lysozyme, methionine core mutant, protein engineering, protein folding, hydrolase
Deposited on 1999-08-20, released 1999-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • engineered (53)
      • engineered (96)
      • engineered (77)
    Domains in SCOPe 2.07: d1cu0a_
  • Heterogens: CL, HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cu0A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgmlrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cu0A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgmlrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk