PDB entry 1ctz

View 1ctz on RCSB PDB site
Description: mutation of tyrosine-67 in cytochrome c significantly alters the local heme environment
Class: electron transport (heme protein)
Keywords: electron transport (heme protein)
Deposited on 1993-02-15, released 1993-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • conflict (71)
      • conflict (106)
    Domains in SCOPe 2.08: d1ctza_
  • Heterogens: SO4, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ctzA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmsefltnpkkyipgtkmafgglkkekdrndlitylkkate