PDB entry 1cty

View 1cty on RCSB PDB site
Description: mutation of tyrosine-67 in cytochrome c significantly alters the local heme environment
Class: electron transport (heme protein)
Keywords: electron transport (heme protein)
Deposited on 1993-02-15, released 1993-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • conflict (71)
      • conflict (106)
    Domains in SCOPe 2.05: d1ctya_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ctyA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmsefltnpkkyipgtkmafgglkkekdrndlitylkkate