PDB entry 1cty

View 1cty on RCSB PDB site
Description: mutation of tyrosine-67 in cytochrome c significantly alters the local heme environment
Deposited on 1993-02-15, released 1993-07-15
The last revision prior to the SCOP 1.67 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d1cty__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cty_ (-)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmsefltnpkkyipgtkmafgglkkekdrndlitylkkate