PDB entry 1ctx

View 1ctx on RCSB PDB site
Description: three-dimensional structure of the-long-neurotoxin from cobra venom
Class: toxin
Keywords: toxin
Deposited on 1982-04-08, released 1982-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-cobratoxin
    Species: Naja siamensis [TaxId:84476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ctxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ctxA (A:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptrkrp