PDB entry 1ctx

View 1ctx on RCSB PDB site
Description: three-dimensional structure of the-long-neurotoxin from cobra venom
Class: toxin
Keywords: toxin
Deposited on 1982-04-08, released 1982-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-cobratoxin
  Species: Naja siamensis [TaxId:84476]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01391 (0-70)
  Domains in SCOPe 2.08: d1ctxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ctxA (A:)
  ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
  ncnpfptrkrp