PDB entry 1ctt

View 1ctt on RCSB PDB site
Description: transition-state selectivity for a single oh group during catalysis by cytidine deaminase
Class: hydrolase
Keywords: hydrolase
Deposited on 1995-02-11, released 1995-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine deaminase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ctta1, d1ctta2
  • Heterogens: ZN, DHZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cttA (A:)
    mhprfqtafaqladnlqsalepiladkyfpalltgeqvsslksatgldedalafallpla
    aacartplsnfnvgaiargvsgtwyfganmefigatmqqtvhaeqsaishawlsgekala
    aitvnytpcghcrqfmnelnsgldlrihlpgreahalrdylpdafgpkdleiktllmdeq
    dhgyaltgdalsqaaiaaanrshmpyskspsgvaleckdgrifsgsyaenaafnptlppl
    qgalillnlkgydypdiqravlaekadapliqwdatsatlkalgchsidrvlla