PDB entry 1cts

View 1cts on RCSB PDB site
Description: crystallographic refinement and atomic models of two different forms of citrate synthase at 2.7 and 1.7 angstroms resolution
Class: oxo-acid-lyase
Keywords: oxo-acid-lyase
Deposited on 1984-01-27, released 1984-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ctsa_
  • Heterogens: CIT

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ctsA (A:)
    asstnlkdiladlipkeqariktfrqqhgntvvgqitvdmmyggmrgmkglvyetsvldp
    degirfrgysipecqkmlpkakggeeplpeglfwllvtgqipteeqvswlskewakraal
    pshvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegihrtkyweliyedcmdlia
    klpcvaakiyrnlyregssigaidskldwshnftnmlgytdaqftelmrlyltihsdheg
    gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
    lrdyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlphdpmfklvaqlykivpnv
    lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
    rpksmstdgliklvdsk