PDB entry 1ctp

View 1ctp on RCSB PDB site
Description: structure of the mammalian catalytic subunit of camp-dependent protein kinase and an inhibitor peptide displays an open conformation
Class: transferase/transferase inhibitor
Keywords: TRANSFERASE(PHOSPHOTRANSFERASE), TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 1993-04-08, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.19
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cAMP-DEPENDENT PROTEIN KINASE
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ctpe_
  • Chain 'I':
    Compound: cAMP-dependent protein kinase inhibitor, alpha form
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MYR, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ctpE (E:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khketgnhfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ctpE (E:)
    kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhketg
    nhfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvmeyvpgg
    emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
    fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
    yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
    qrkveapfipkfddyeeeeirvsekcgkefsef
    

  • Chain 'I':
    No sequence available.