PDB entry 1cto

View 1cto on RCSB PDB site
Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, minimized average structure
Class: binding protein
Keywords: binding protein, cytokine receptor
Deposited on 1996-09-25, released 1997-10-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: granulocyte colony-stimulating factor receptor
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40223 (0-108)
  Domains in SCOPe 2.08: d1ctoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ctoA (A:)
  gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
  hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk