PDB entry 1ctn

View 1ctn on RCSB PDB site
Description: crystal structure of a bacterial chitinase at 2.3 angstroms resolution
Class: lyase (oxo-acid)
Keywords: lyase (oxo-acid)
Deposited on 1994-10-10, released 1995-02-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.162
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase a
    Species: Serratia marcescens [TaxId:615]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07254 (0-End)
      • conflict (49)
      • conflict (202)
      • conflict (327)
      • conflict (371)
      • conflict (413)
      • conflict (449)
    Domains in SCOPe 2.04: d1ctna1, d1ctna2, d1ctna3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ctnA (A:)
    aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakillng
    keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvadtdgshlaplke
    plleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfipicggnginds
    lkeiegsfqalqrscqgredfkisihdpfaalqkaqkgvtawddpykgnfgqlmalkqah
    pdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdidwefpggkgan
    pnlgspqdgetyvllmkelramldqlstetgrkyeltsaisagkdkidkvaynvaqnsmd
    hiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgvkpgkivvgtam
    ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
    vfkpstgdlitfddarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ctnA (A:)
    aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakillng
    keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvadtdgshlaplke
    plleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfipicggnginds
    lkeiegsfqalqrscqgredfkisihdpfaalqkaqkgvtawddpykgnfgqlmalkqah
    pdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdidwefpggkgan
    pnlgspqdgetyvllmkelramldqlstetgrkyeltsaisagkdkidkvaynvaqnsmd
    hiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgvkpgkivvgtam
    ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
    vfkpstgdlitfddarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsag