PDB entry 1ctm

View 1ctm on RCSB PDB site
Description: crystal structure of chloroplast cytochrome f reveals a novel cytochrome fold and unexpected heme ligation
Class: electron transport(cytochrome)
Keywords: electron transport(cytochrome)
Deposited on 1994-01-02, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome f
    Species: Brassica rapa [TaxId:3711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ctma1, d1ctma2
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ctmA (A:)
ypifaqqnyenpreatgrivcanchlaskpvdievpqavlpdtvfeavvkipydmqlkqv
langkkgalnvgavlilpegfelappdrispemkekignlsfqnyrpnkknilvigpvpg
qkyseitfpilapdpatnkdvhflkypiyvggnrgrgqiypdgsksnntvynataggiis
kilrkekggyeitivdasnerqvidiiprglellvsegesikldqpltsnpnvggfgqgd
aeivlqdplr