PDB entry 1ctl

View 1ctl on RCSB PDB site
Description: structure of the carboxy-terminal lim domain from the cysteine rich protein crp
Deposited on 1995-01-06, released 1995-06-03
The last revision prior to the SCOP 1.55 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1ctl_1, d1ctl_2

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ctl_ (-)
  maqkvggsdgcprcgqavyaaekvigagkswhkscfrcakcgkslesttladkdgeiyck
  gcyaknfgpkgfgfgqgagalihsq