PDB entry 1ctj

View 1ctj on RCSB PDB site
Description: crystal structure of cytochrome c6
Deposited on 1995-08-08, released 1996-06-10
The last revision prior to the SCOP 1.57 freeze date was dated 1996-06-10, with a file datestamp of 1996-06-11.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.1397
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1ctj__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ctj_ (-)
  eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
  mpawdgrldedeiagvaayvydqaagnkw