PDB entry 1cte

View 1cte on RCSB PDB site
Description: crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design
Class: thiol protease
Keywords: thiol protease
Deposited on 1995-05-03, released 1995-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.166
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00787 (0-End)
      • conflict (114)
      • conflict (222)
    Domains in SCOPe 2.07: d1ctea_
  • Chain 'B':
    Compound: cathepsin b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00787 (0-End)
      • conflict (114)
      • conflict (222)
    Domains in SCOPe 2.07: d1cteb_
  • Heterogens: PYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cteA (A:)
    lpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvevsaedll
    tccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvngarppct
    gegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaftvfsdf
    ltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkilrgenhc
    gieseivagiprtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cteA (A:)
    lpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvevsaedll
    tccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvngarppct
    gegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaftvfsdf
    ltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkilrgenhc
    gieseivagiprt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cteB (B:)
    lpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvevsaedll
    tccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvngarppct
    gegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaftvfsdf
    ltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkilrgenhc
    gieseivagiprtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cteB (B:)
    lpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvevsaedll
    tccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvngarppct
    gegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaftvfsdf
    ltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkilrgenhc
    gieseivagiprt