PDB entry 1ct9

View 1ct9 on RCSB PDB site
Description: crystal structure of asparagine synthetase b from escherichia coli
Deposited on 1999-08-20, released 1999-12-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-15, with a file datestamp of 1999-12-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ct9A (A:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyaarrvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihft
    vqegldairdviyhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyf
    hkapnakelheetvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdk
    mcgngkmekhilrecfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqleta
    rfrfpyntptskeaylyreifeelfplpsaaecvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ct9A (A:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyalhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdviyhie
    tydvttirastpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelheetvrk
    llalhmydcarankamsawgvearvpfldkkfldvamrinpqdkmckmekhilrecfeay
    lpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqletarfrfpyntptskeaylyre
    ifeelfplpsaaecvpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ct9B (B:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyaarrvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihft
    vqegldairdviyhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyf
    hkapnakelheetvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdk
    mcgngkmekhilrecfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqleta
    rfrfpyntptskeaylyreifeelfplpsaaecvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ct9B (B:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyawpqlhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdviy
    hietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelheet
    vrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdkmckmekhilrecf
    eaylpasvawrqdgvgyswidtlkevaaqqvsdqqletarfrfpyntptskeaylyreif
    eelfplpsaaecvpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ct9C (C:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyaarrvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihft
    vqegldairdviyhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyf
    hkapnakelheetvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdk
    mcgngkmekhilrecfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqleta
    rfrfpyntptskeaylyreifeelfplpsaaecvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ct9C (C:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyawpqlhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdviy
    hietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelheet
    vrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdkmckmekhilrecf
    eaylpasvawrqdgvgyswidtlkevaaqqvsdqqletarfrfpyntptskeaylyreif
    eelfplpsaaecvpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ct9D (D:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyaarrvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihft
    vqegldairdviyhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyf
    hkapnakelheetvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdk
    mcgngkmekhilrecfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqleta
    rfrfpyntptskeaylyreifeelfplpsaaecvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ct9D (D:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyaaqlhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdviyh
    ietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelheetv
    rkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdkmcgkmekhilrecf
    eaylpasvawrqdgvgyswidtlkevaaqqvsdqqletarfrfpyntptskeaylyreif
    eelfplpsaaecvpg