PDB entry 1ct9

View 1ct9 on RCSB PDB site
Description: crystal structure of asparagine synthetase b from escherichia coli
Class: ligase
Keywords: amidotransferase, substrate channeling, asparagine biosynthesis, ligase
Deposited on 1999-08-20, released 1999-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: asparagine synthetase b
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22106 (0-End)
      • engineered (0)
    Domains in SCOPe 2.07: d1ct9a1, d1ct9a2
  • Chain 'B':
    Compound: asparagine synthetase b
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22106 (0-End)
      • engineered (0)
    Domains in SCOPe 2.07: d1ct9b1, d1ct9b2
  • Chain 'C':
    Compound: asparagine synthetase b
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22106 (0-End)
      • engineered (0)
    Domains in SCOPe 2.07: d1ct9c1, d1ct9c2
  • Chain 'D':
    Compound: asparagine synthetase b
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22106 (0-End)
      • engineered (0)
    Domains in SCOPe 2.07: d1ct9d1, d1ct9d2
  • Heterogens: IUM, CL, AMP, GLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ct9A (A:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyaarrvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihft
    vqegldairdviyhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyf
    hkapnakelheetvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdk
    mcgngkmekhilrecfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqleta
    rfrfpyntptskeaylyreifeelfplpsaaecvpggpsvacssakaiewdeafkkmddp
    sgravgvhqsayk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ct9A (A:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyalhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdviyhie
    tydvttirastpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelheetvrk
    llalhmydcarankamsawgvearvpfldkkfldvamrinpqdkmckmekhilrecfeay
    lpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqletarfrfpyntptskeaylyre
    ifeelfplpsaaecvpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ct9B (B:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyaarrvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihft
    vqegldairdviyhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyf
    hkapnakelheetvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdk
    mcgngkmekhilrecfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqleta
    rfrfpyntptskeaylyreifeelfplpsaaecvpggpsvacssakaiewdeafkkmddp
    sgravgvhqsayk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ct9B (B:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyawpqlhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdviy
    hietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelheet
    vrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdkmckmekhilrecf
    eaylpasvawrqdgvgyswidtlkevaaqqvsdqqletarfrfpyntptskeaylyreif
    eelfplpsaaecvpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ct9C (C:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyaarrvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihft
    vqegldairdviyhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyf
    hkapnakelheetvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdk
    mcgngkmekhilrecfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqleta
    rfrfpyntptskeaylyreifeelfplpsaaecvpggpsvacssakaiewdeafkkmddp
    sgravgvhqsayk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ct9C (C:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyawpqlhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdviy
    hietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelheet
    vrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdkmckmekhilrecf
    eaylpasvawrqdgvgyswidtlkevaaqqvsdqqletarfrfpyntptskeaylyreif
    eelfplpsaaecvpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ct9D (D:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyaarrvedqerseawwpqlhsfavglpgspdlkaaqevanhlgtvhheihft
    vqegldairdviyhietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyf
    hkapnakelheetvrkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdk
    mcgngkmekhilrecfeaylpasvawrqkeqfsdgvgyswidtlkevaaqqvsdqqleta
    rfrfpyntptskeaylyreifeelfplpsaaecvpggpsvacssakaiewdeafkkmddp
    sgravgvhqsayk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ct9D (D:)
    asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
    plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
    fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
    wsqdgeirsyyhrdwfdydavkdnvtdknelrqaledsvkshlmsdvpygvllsggldss
    iisaitkkyaaqlhsfavglpgspdlkaaqevanhlgtvhheihftvqegldairdviyh
    ietydvttirastpmylmsrkikamgikmvlsgegsdevfggylyfhkapnakelheetv
    rkllalhmydcarankamsawgvearvpfldkkfldvamrinpqdkmcgkmekhilrecf
    eaylpasvawrqdgvgyswidtlkevaaqqvsdqqletarfrfpyntptskeaylyreif
    eelfplpsaaecvpg