PDB entry 1ct7

View 1ct7 on RCSB PDB site
Description: solution structure of type x cbd
Class: hydrolase
Keywords: beta strands, antiparallel sheets
Deposited on 1999-08-19, released 2000-02-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2000-10-09, with a file datestamp of 2007-06-28.
Experiment type: NMR5
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: PSEUDOMONAS FLUORESCENS, SUBSP. CELLULOSA
    Database cross-references and differences (RAF-indexed):
    • PIR S06047 (0-49)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1ct7a1, d1ct7a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct7A (A:)
    mgnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg