PDB entry 1ct5

View 1ct5 on RCSB PDB site
Description: crystal structure of yeast hypothetical protein ybl036c-selenomet crystal
Deposited on 1999-08-18, released 1999-09-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-02, with a file datestamp of 1999-09-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ct5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ct5A (A:)
    tgitydedrktqliaqyesvrevvnaeaknvhvnenaskilllvvsklkpasdiqilydh
    gvrefgenyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakk
    lnesrakfqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmt
    igswnvshedskenrdfatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigt
    difg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ct5A (A:)
    tgitydedrktqliaqyesvrevvnaeaknvkilllvvsklkpasdiqilydhgvrefge
    nyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakklnesrak
    fqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmtigswnrd
    fatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigtdifg