PDB entry 1ct3

View 1ct3 on RCSB PDB site
Description: cleaved antichymotrypsin t345r
Deposited on 1996-12-16, released 1997-03-12
The last revision was dated 1997-03-12, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.189
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cleaved antichymotrypsin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01011
      • engineered (327)
  • Chain 'B':
    Compound: cleaved antichymotrypsin
    Species: HOMO SAPIENS

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ct3A (A:)
    thvdlelasanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkg
    lkfnltetseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlyg
    seafatdfqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfd
    pqdthqsrfylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqd
    kmeeveamllpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskad
    lsgitgarnlavsqvvhkavldvfeegreasaatavkitll
    

    Sequence, based on observed residues (ATOM records):
    >1ct3A (A:)
    sanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkglkfnltet
    seaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseafatdf
    qdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpqdthqsr
    fylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmeeveam
    llpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitgar
    nlavsqvvhkavldvfeegreasaatavkitll
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ct3B (B:)
    vetrtivrfnrpflmiivptdtqniffmskvtnpkqa
    

    Sequence, based on observed residues (ATOM records):
    >1ct3B (B:)
    rtivrfnrpflmiivptdtqniffmskvtnpkq